연구용제품시약 > 기타
Biolegend 한국대리점 Recombinant Human AXL-Fc Chimera
바이오클론
Biolegend (www.biolegend.com)
한국대리점(www.bioclone.co.kr)
New Recombinant Protein 출시
Recombinant Human AXL-Fc Chimera (carrier-free)Cat No. 790902, 790904, 790906, 790908 Source :
Human AXL, amino acid Glu33-Pro441 (Accession # NP_068713.2), with a linker (SR) and a C-terminal human IgG1-Fc and a 6His tag, was expressed in 293E cells. Activity :Recombinant human AXL-Fc chimera binds to immobilized recombinant human GAS-6 in a dose-dependent manner. The ED50 for this effect is 2 – 10 ng/mL. |
Recombinant human AXL-Fc chimera binds to immobilized recombinant human GAS-6 in a dose-dependent manner. The ED50 for this effect is 2 - 10 ng/mL. |
Recombinant Human Uncarboxylated Osteocalcin (ELISA Std.)Cat No. 446709 Source : YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV (synthetic peptide)
Activity : YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV |
Representative sandwich immunoassay standard curve generated using serial dilutions of Human Uncarboxylated Osteocalcin (Cat. No. 446709) ranging from 37.5 to 2400 pg/mL, 8H4 (Cat. No. 538202) as the capture antibody at 4 µg/mL, and 4B6 (Cat. No. 538304) as the detection antibody at 0.5 µg/mL. |
Recombinant Mouse B7-H2 (ICOSL)-Fc Chimera (carrier-free)Cat No. 792704, 792706 Source : Mouse B7-H2, amino acid Glu47-Lys279 (Accession # Q9JHJ8), with a C-terminal mouse IgG2a (Glu99-Lys330), was expressed in CHO cells. Activity : When recombinant mouse B7-H2 (ICOSL)-Fc chimera is immobilized at 2 μg/mL, biotinylated mouse ICOS binds in a dose-dependent manner. The EC50 range for this effect is 50 - 200 ng/mL. HRP Avidin (Cat. No. 405103) was used to detect the binding. |
When recombinant mouse B7-H2 (ICOSL)-Fc chimera is immobilized at 2 µg/mL, biotinylated mouse ICOS binds in a dose-dependent manner. The EC50 range for this effect is 50 - 200 ng/mL. HRP Avidin (Cat. No. 405103) was used to detect the binding. |
바이오클론(주)
email : bioclone@bioclone.co.kr
TEL : 02-2690-0058
Flow Cytometry Antibodies is Biolegend !!
본 정보는 "바이오클론" (으)로 문의 바랍니다.