연구용제품시약 > Chemical Reagent
[바이오클론] [MedChemExpress한국독점대리점]Exendin (5-39)
바이오클론
Signaling Pathway에 관련된 Biological Inhibitors와 Biochemical Reagent 제조, 공급하는 회사인 MedChemExpress(MCE)를 소개합니다.(USA)
www.medchemexpress.com/
한국 독점대리점:바이오클론 ( www.bioclone.co.kr )
바이오클론(주)는 MedChem Express(MCE)의 한국공식독점대리점이며, 2015년부터 정부의 화학물질의 등록 및 평가 등에 관한 법률(화평법)에 의해 모든 화학물질을 한국환경공단에 신고, 허가 하에 안전하게 수입 공급하고 있습니다.
Description |
Exendin (5-39) is a potent glucagon-like peptide 1 (GLP-1) receptor antagonist. Exendin (5-39) improves memory impairment in β-amyloid protein-treated rats. |
||||||||
---|---|---|---|---|---|---|---|---|---|
IC50 & Target |
IC50: GLP-1 receptor[1] |
||||||||
In Vivo |
Exendin (5-39) (intracerebroventricular injection; 0.3 μg; once daily; 1-week) increases GLT-1 protein levels in the hippocampus of male Wistar rats. Additionally, hippocampal slices are prepared from Ex-treated or vehicle rats,Exendin (5-39) decreases fEPSP decay time and increases the input-output relation and decreased the paired-pulse ratio in the dentate gyrus (DG). Furthermore, Ex inhibits long-term depression but not long-term potentiation in the DG[1].
|
||||||||
Molecular Weight |
3806.30 |
||||||||
Formula |
C₁₆₉H₂₆₂N₄₄O₅₄S |
||||||||
CAS No. |
196109-27-0 |
||||||||
Sequence Shortening |
TFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
||||||||
Shipping |
Room temperature in continental US; may vary elsewhere. |
||||||||
Storage |
Please store the product under the recommended conditions in the Certificate of Analysis. |
||||||||
References |
본 정보는 "바이오클론" (으)로 문의 바랍니다.