[DEBUG-WINDOW 처리영역 보기]
즐겨찾기  |  뉴스레터  |  오늘의 정보  |  e브릭몰e브릭몰 회원가입   로그인
BRIC홈 동향
실험복 제공
스폰서배너광고 안내  배너1 배너2 배너3
전체보기 뉴스 Bio통신원 Bio통계 BRIC이만난사람들 웹진(BioWave)
BRIC View
최신자료 동향리포트 학회참관기 리뷰논문요약 BRIC리포트 외부보고서
알츠하이머병에서의 산화적 스트레스와 아밀로이드 베타 펩타이드
알츠하이머병에서의 산화적 스트레스와 아밀로이드 베타 펩타이드 저자 김희정
등록일 2019.10.01
자료번호 BRIC VIEW 2019-R25
조회 1987  인쇄하기 주소복사 트위터 공유 페이스북 공유 
요약문
산화적 스트레스(oxidative stress)는 다양한 질병에 있어서 중요한 역할을 하고 있다. 특히, 노화에 의한 신경퇴행성 질환이면서, 노인에게 발병하는 치매의 가장 흔한 원인인 알츠하이머병 (Alzheimer’s disease; AD)의 원인과 연관되어 있다. 알츠하이머병의 조직병리학적 특징은 세포 내의 신경섬유엉킴(neurofibrillary tangle)과 세포 밖에 형성되는 노인성 반점(senile plaque)이다. 노인성 반점은 아밀로이드 베타 펩타이드(amyloid-beta peptide; Aβ)가 구리, 철, 아연 등의 금속 이온과 함께 뭉쳐진 형태이다. 구리와 같이 산화, 환원 반응이 활발한 금속 이온은 Aβ와 결합하여 활성산소종(reactive oxygen species; ROS)의 생성을 촉진시킬 수 있다. 이렇게 생성된 ROS 중, 반응성이 가장 큰 것은 수산화 라디칼(hydroxyl radical)인데, 이는 Aβ 자체나 주변의 분자들(단백질, 지질, 등)을 산화시킬 수 있다. 이 리뷰 논문에서는 산화적 스트레스와 알츠하이머병의 상관관계와 Aβ와 주변의 분자들의 산화적 손상에 의한 결과를 주로 다루려고 한다. 추가적으로, 알츠하이머병에 대한 금속 이온의 영향, 금속 이온과 Aβ의 결합, 그리고 ROS를 만드는 금속 이온의 산화-환원 성질과 분자적 수준에서 Aβ의 체외(in vitro), 체내(in vivo)에서의 산화에 대해 논의하려고 한다.
키워드: oxidative stress, amyloid beta peptide, metal-ions, reactive oxygen species, oxidative damages, MicroED

본 자료는 Oxidative stress and the amyloid beta peptide in Alzheimer’s disease. Redox Biol., 14:450-464.의 논문을 한글로 번역, 요약한 자료입니다.

목차

1. 서론
2. 산화적 스트레스와 알츠하이머병의 연관성
  2.1. 알츠하이머병의 정의와 특징
  2.2. Aβ와 아밀로이드 플라크의 형성
  2.3. 주변 분자들의 산화
    2.3.1. AD에서의 산화적/질산화적(nitrosative) 스트레스의 증거
    2.3.2. 막의 상태와 단백질의 기능에 영향을 미치는 생체 분자 산화의 결과
3. AD에서 금속의 영향
  3.1. 뇌에서의 금속의 역할
  3.2. AD에서의 오조정(misregulation)
  3.3. 금속과 산화적 스트레스
4. Aβ 펩타이드와 ROS 생성
  4.1. Aβ와 금속 이온의 조화
    4.1.1. Zn(II)와 Aβ의 배위 결합
    4.1.2. Cu(II)와 Aβ의 배위 결합
    4.1.3. Cu(I)와 Aβ의 배위 결합
    4.1.4. Fe(II)와 Aβ의 배위 결합
  4.2. Aβ-금속에 의한 ROS 생성
5. Aβ에 의한 산화적 손상
  5.1. 체외에서의 금속 촉매에 의한 산화(metal-catalyzed oxidation, MCO) 과정 중, Aβ 잔기의 손상
    5.1.1. 아스파르트산의 산화
    5.1.2. 히스티딘의 산화
    5.1.3. 페닐알라닌의 산화
    5.1.4. 티로신의 산화
    5.1.5. 메티오닌의 산화
    5.1.6. 기타 절단
6. 전망과 앞으로의 연구


1. 서론

에너지 변환은 생명의 가장 근본적인 작용 중 하나이다. 에너지 변환은 생명의 근원부터 존재했으며, 이온이 반투막을 통과하는 것과 같은 기본적인 메커니즘은 모든 살아있는 생물에 존재한다. 이온 농도 구배(gradient)를 ATP와 같은 화학적 에너지로 변환시키는 효소의 전반적인 디자인은 생물 전반에 걸쳐 동일하다.

전자 전달 반응은 막을 경계로 이온 농도 구배를 형성하는데 사용된다. 바꾸어 말하면, 이는 전자들이 첫 번째 공여자에서 시작하여 몇몇 중간체를 거쳐 최종 수용체에 전달되는 산화-환원 반응이다. 인간, 동물, 수많은 다른 생물체에서의 최종 전자 수용체는 dioxygen이다. 이 최종 전자 수용체의 장점은 높은 산화-환원 잠재력이며, 이로 인한 반응에서의 높은 에너지이다.

upload_image

원칙적으로 전자 공여자는 우리가 섭취한 음식물이다. 우리의 삶에 필요한 에너지는 음식물과 O2의 산화-환원 반응으로부터 유래한다. (1)번 반응에서, O2는 네 개의 전자와 네 개의 양성자를 받아들이고, 두 개의 물 분자를 생산해 낸다. (2)번 반응에서, 부분적인 O2의 환원이 superoxide anion (O2•–), 과산화수소(H2O2), 그리고 수산화 라디칼(hydroxyl radical:HO)을 만들어낸다.

upload_image

이러한 중간산물들은 HO처럼 매우 반응성이 커서 조절하기 힘든 물질이거나, (O2•– + NO → peroxynitrite 반응에서처럼) 반응성이 크고 조절하기 힘든 물질로 쉽게 바뀌는 전구체들이다. O2와 유기(organic) 전자 공여자의 반응이 열역학적으로는 유리하지만, 이는 O2의 삼중 기저 상태에 의해 동역학적으로 저해된다. 그러므로 (1)번 반응은 부분적인 환원 반응이 일어나는 (2)번 반응이 거의 일어나지 않도록 잘 조절될 수 있다. 부분적으로 환원된 산소 종류들인 O2•–, H2O2, HO는 활성산소종(reactive oxygen species;ROS)에 포함된다. ROS는 반응성을 가진 산소를 포함하는 화학물질이라고 정의된다. 산소를 최종 전자 수용체로 이용하는 호기성 환경 내에 존재하는 생명체는 결과적으로 몸 속에서 지속적으로 ROS를 생성하게 된다. ROS는 효소적으로 (예를 들면 대식세포(macrophage)가 침입자를 죽이기 위해) 혹은 부반응으로 비효소적으로 생성된다. 후자는 거의 모든 생리적 반응이 (1)번 반응인 호흡 연쇄(respiratory chain)에서 일어나는데, 이 때 원치 않는 부반응이 ROS를 생성하게 된다. 몸에서 만들어진 대부분의 ROS는 호흡 연쇄에서 생성되고, 위험성을 안고 있다. 그러므로 몇몇 효소와 작은 물질들이 ROS의 양을 조절하기 위해 존재한다. 일반적으로 ROS는 적은 양으로 유지되며 완전히 제거되지는 않는다. ROS는 세포 신호 전달 기능도 있기 때문에, 전체적인 억제는 해롭다. 많은 양의 ROS의 축적은 위험하고, 이는 산화적 스트레스(oxidative stress)라고 정의되어 있다.

ROS의 제거는 항산화물질에 의해 다양한 기전으로 일어나게 된다. 항산화물질을 정의하자면, 산화될 수 있는 기질 보다 적은 양으로 기질의 산화를 저해하거나 막을 수 있는 내인성 혹은 외인성 물질이다. ROS 제거의 다양한 기전으로는 i) ROS의 포식(scavenging of ROS), ii) ROS의 제거(quenching of ROS), iii) 내인성 항산화제의 재생산(regeneration of endogenous antioxidants) 같은 것들이 있다.

알츠하이머나 파킨슨병과 같은 신경변성질환(neurodegenerative disease)에서 뇌는 산화적 손상을 보이고, 많은 경우에 산화적 스트레스가 관련되어 있음을 볼 수 있다. 뇌는 특별히 산화적 스트레스에 의한 산화적 손상을 잘 입는데, 이는 뇌가 매우 많은 양의 산소를 소비하기 때문이다(신체 전체 소비량의 20%). 비록 몇몇 신경변성질환에서 산화적 스트레스의 발생이 비교적 잘 알려졌으나, 이것이 질병의 원인인지 결과인지에 대해서는 답하기 힘든 상황이다.

2. 산화적 스트레스와 알츠하이머병(Alzheimer’s disease; AD)의 연관성

2.1. AD의 정의와 특징

1907년, Alois Alzheimer는 “대뇌 피질의 특이한 질병에 관하여”라는 논문에서 기억력 상실, 방향감각 상실, 환각, 인지 장애로 고통받고 있는 51세 환자의 경우에 대해 언급하였다. 이 환자의 사후 조사를 통해, “특이한 물질이 뇌 피질에 쌓임”으로 인한 “신경섬유의 놀라운 변화”와 “미세한 군사 초첨(minute military foci)”이 환자의 위축된 뇌에서 발견되었다. 한 세기가 지나서, AD이라는 이름이 붙여진 이 “특이한 질병”은 아직까지도 원인이 밝혀지지 않은 가장 흔한 신경변성질환이 되었다. World Alzheimer Report에 따르면, 2015년 현재, 4,680만명이 치매로 고통받고 있다. 이는 20년마다 두 배씩 증가할 것으로 예상된다. 65세 이상의 약 5-8%, 75세 이상의 15-20%, 85세 이상의 25-50%가 치매에 걸린다. 유럽과 아프리카의 환자수가 각각 2,050만명, 940만명인데 비해, 아시아(2,290만명)의 환자수가 가장 많다.

AD는 점차적인 인지 기능의 감퇴가 특징인데, 이는 상당한 정도로 뇌의 부피가 줄어드는 것과 상관성이 있다. 이러한 뇌의 위축은 특히 기억과 방향을 담당하는 해마에서의 시냅스의 퇴화와 신경세포 사멸의 결과이다. AD의 최대 위험 요소는 연령인데, 85세가 넘어가면 발병률이 50%에 이른다. 여성의 수명이 더 길고, 폐경으로 인한 에스트로겐의 감소가 AD의 발병을 증가시키기 때문에, 여성이 남성에 비해 AD에 더 취약하다.

전반적인 뇌 부피의 감소 외에도, Alois Alzheimer가 처음 언급했던,“ 특이한 물질이 피질에 쌓임”으로 인한 뇌의 아밀로이드 플라크(amyloid plaque)는 AD의 특징 중 하나이다. 노인성 반점(senile plaque)이라고도 불리우는 이 플라크는 AD 환자의 해마의 세포 바깥 공간에서 발견된다. 이는 주로 아밀로이드 베타(Amyloid-β)라는 펩타이드(Aβ)로 구성되어 있는데, 이는 서로 엉겨 붙어 있고, 대부분 β-sheet 구조가 많은 섬유질이다. 또 하나의 특징은 파킨슨병에서도 발견되는 과인산화된 타우(Tau) 단백질로 이루어진 신경섬유엉킴(neurofibrillary tangle)이 뇌세포 안에 존재한다는 것이다. 세포 내 미소관(microtubule)과 연관된 이 단백질은 튜블린(tubulin)과 결합하여 미소관을 안정화 시킨다. AD와 파킨슨병에서는 Aβ가 p38 MAPK을 활성화 시키고, 활성화 된 p38 MAPK가 타우를 비정상적으로 인산화 시킨다. 이는 신경세포 안에서 헬릭스 구조의 쌍을 이루고 있는 필라멘트를 신경섬유엉킴의 형태로 축적시켜서 미소관을 불안정하게 하고, 신경의 기능을 잃게 만든다.

2.2. Aβ와 아밀로이드 플라크의 형성

Aβ는 아미노산 38-43개로 이루어진 DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAT의 시퀀스를 가진 펩타이드이다. 여러 조직 특히 중추신경계에 존재하는 타입 1 트랜스 멤브레인 단백질인 아밀로이드 프리커서 프로테인(Amyloid precursor protein; APP)이 β- 와 γ-secretase에 의해 잘려 생성된다. 신경에 존재하는 APP의 주요한 아이소폼은 695개의 아미노산 잔기를 가지고 있다. 비록 생리적 기능은 아직 알려지지 않았지만, APP는 뇌의 발달, 기억과 시냅스 가소성에 중요한 역할을 할 것으로 생각된다. APP는 서로 다른 두 가지 경로로 대사 된다 (그림 1). 비아밀로이드 경로(우세함)에서는 APP가 먼저 α-secretase에 의해 절단되고, 그리고 나서 γ-secretase에 의해 절단되어 Aβ17-40 (P3) 펩타이드를 형성하거나 β-secretase에 의해 절단되어 Aβ1-16 펩타이드를 형성한다. 경미한 정도로 일어나는 아밀로이드 대사 경로에서는 APP가 β-secretase, γ-secretase에 의해 차례대로 절단되어 온전한 Aβ 펩타이드(주로 Aβ1-40/42)가 생성된다. 두 경로 모두 먼저 N 말단 조각(secreted APP (sAPP) α 혹은 β)과 C 말단 조각(CTF83 혹은 CTF99)을 생성한 후, N 말단 APP intracellular domain (AICD)를 생성한다. AICD는 세포 핵의 신호 전달에 관여되어 있다. γ-secretase의 절단 위치에 따라, Aβ1-38에서부터 Aβ1-43까지 여러 가지 길이의 펩타이드가 생성된다. 뇌에서 가장 많이 생성되는 종류는 Aβ1-40이고 그 다음으로 Aβ1-42가 많이 생성된다. APP 절단의 세 번째 방법은 최근에 발견되었다. 여기에는 APP의 504-505 아미노산 사이를 절단하는 η-secretase가 관여되는데, α-와 β-secretase에 의해 2차로 절단되고 나면, 더 큰 분자량을 가진 C 말단 조각인 Aη-α와 Aη-β가 생성되게 된다. Aη-α는 Aβ1-16을 포함하고 있으며, 신경 독성이 있다고 알려져 있다.

 

upload_image
그림 1. APP 단백질 절단의 모식도

 

그러므로, Aβ 펩타이드는 APP 대사 중 주요하지 않은 대사 경로로부터 생성되는 것이다. 건강한 뇌에서는 신경 활동을 하는 동안 주로 엔도좀 같은 세포 내 소낭(vesicle)에서 생성되어서 세포 밖 공간으로 분비된다. Aβ는 뇌의 Aβ 양을 조절하는 Aβ-degrading protease (AβDP)에 의해 분해된다. Aβ가 신경 가소성과 기억에 작용할 수도 있겠지만, 아직 Aβ의 기능은 아직 잘 알려져 있지 않다.

AD는 산발적이고 고령에 발생하는 가장 흔한 형태와 5% 미만으로 발생하는 가족 유전성이거나 조기 발병하는 두 가지 형태가 있다. 다운증후군(3염색체성 21 (trisomy 21)이라고도 불리우는)을 앓고 있는 사람들은 조기 발병 AD의 위험성이 높다. 왜냐하면 그들은 21번 염색체를 추가로 더 가지고 있는데, 이 부위에 APP를 생성하는 유전자가 존재하기 때문이다. ApoE (Aβ의 제거에 관여하는)의 돌연변이는 고령에 발병하는 AD의 가장 흔한 유전적 위험 인자로 간주되고 있는 반면에, APP와 Presenilin 1, Presenilin 2 (γ-secretase의 두 개의 서브유닛)를 코딩하는 AD의 원인 유전자로 알려진 몇몇 유전자들의 돌연변이는 주로 조기 발병 AD의 원인으로 알려졌다. PSEN1과 PSEN2 유전자의 돌연변이는 더 많은 Aβ 생성으로 이어지고, PSEN1의 돌연변이는 특히 Aβ1-42의 형성을 증가시킨다. Alzheimer Disease & Frontotemporal Dementia Mutation Database에서 보면, APP에 65개의 돌연변이가 존재하는데, 이 중 15개만이 비병원성이다. APP의 돌연변이는 Aβ 부분에서 발생할 수도 있기 때문에, β- 와 γ-secretase에 의한 APP의 절단이 변형된 Aβ의 형성을 야기할 수 있다(가장 흔한 경우는 그림 2에 정리했음). 돌연변이는 세 가지 카테고리로 나뉘어진다. β-secretase의 절단 부위(N 말단), γ-secretase의 절단 부위(C 말단), 그리고 Aβ 부위의 중간 부분의 돌연변이이다. γ-secretase의 절단 부위의 돌연변이는 절단 부위를 변경시킬 수 있고, Aβ1-42/Aβ1-40의 비율을 증가시킬 수 있다. β-secretase의 절단 부위의 돌연변이는 β-secretase에 의한 APP의 절단 속도를 증가시킨다. APP에 포함되어 있는 Aβ의 중간 부분의 돌연변이는 Aβ가 올리고머나 섬유질을 형성하려는 경향성을 증가시켜 Aβ의 뭉침에 영향을 준다.

 

upload_image
그림 2. 가장 흔한 Aβ1-43의 가족성의 AD 변이

 

AD는 많은 요소로 구성된 질병이며 이 질병과 연관된 다양한 메커니즘은 아직 명확하지 않다. Aβ가 건강한 뇌에서는 용해성 있는 형태로 발견되었으나, AD 환자의 뇌에서는 뭉쳐진 형태로 발견되었기 때문에, 노인성 반점의 형성을 설명하는 한 가설이 제시되었다. 비록 여전히 논쟁의 여지가 있음에도 불구하고 1990년대 전기에 형성된 아밀로이드 케스케이드 가설(그림 1)이 AD의 발생에서 우세한 모델이다. 이 가설은 세포 밖 Aβ 양의 비정상적인 증가로 Aβ가 뭉쳐 β-sheet이 많은 구조를 형성하게 만든다고 한다. 뭉침 현상은 올리고머를 형성하면서 시작된다. 이 올리고머는 아밀로이드 플라크에서 발견되는 protofibril과 fibril로 재배열 된다. AD 환자의 뇌 안에서 축적되는 올리고머는 특별히 세포막을 투과하여 세포의 기능 장애나 죽음을 일으킬 수 있기 때문에, 더욱 독성이 있는 종류로 알려졌다. 이 가설에 따르면, 세포 내의 신경섬유엉킴의 형성이나 시냅스 기능의 파괴와 같은 현상이 이러한 현상에 의해 일어날 수도 있다고 한다. 이러한 일련의 과정에 영향을 주는 요인들이 조절인자이다. 산화적 스트레스, 아연, 철, 구리와 같은 금속 이온들이 이런 조절인자들이며, 이 조절인자들은 아밀로이드 플라크에서 발견되었다. 어떤 신경에서는 구리와 아연이 시냅스 사이로 배출된다. 아밀로이드 케스케이드 가설에 따르면, 구리와 아연은 Aβ와 결합하여서 단백질 뭉침 과정을 조절할 수 있기 때문에, 단백질의 뭉침 현상에 있어서 중요한 역할을 할 것으로 생각된다. 구리와 아연은 생성된 단백질 뭉치의 형태에 영향을 미침으로써 동역학 혹은 열역학에 작용한다. 게다가 구리와 같이 산화-환원 작용이 활발한 금속 이온과 함께 뭉쳐진 아밀로이드 단백질 응집체(낮은 분자량)는 Aβ 펩타이드 그 자체와 주변 생체 분자에 유해한 ROS를 생성할 수 있기 때문에, 더욱 독성이 있는 것으로 여겨진다.

2.3. 주변 분자들의 산화

AD의 맥락에서 생체분자의 산화는 신경막의 생체 분자 및 막의 붕괴와 연관되어 있다. 이는 지질(그 중, 콜레스테롤), 단백질, 핵산의 산화를 포함하며, low density lipoprotein receptor-related protein (LRP1)의 산화로 인해 Aβ의 제거에 문제가 생기는 것도 포함한다.

2.3.1. AD에서의 산화적/질산화적(nitrosative) 스트레스의 증거

몇몇 증거들이 산화적 스트레스와 질산화적 스트레스가 AD의 발병에 중요한 역할을 한다는 것을 보여준다. 산화적 스트레스는 AD의 초기에 일어나는데, 이는 AD 발병에 있어서 Aβ와 산화적 스트레스의 역할을 뒷받침 한다. 실제로, AD 환자의 해마와 대뇌 피질 내에 Aβ1-40과 Aβ1-42의 증가된 상태가 단백질, 지질, 핵산의 산화 결과물의 증가와 연관이 있음이 보고되었다 (그림 3). 반면에, Aβ 양이 적은 뇌조직(예를 들면, 소뇌)에는 산화적 스트레스를 보이는 물질들이 없다. 최근에, Aβ가 풍부한 뇌 부위에서 단백질과 지질의 산화가 관찰된 것으로 확인되었으며, 여기서 redox proteomics는 질병의 초기 단계에서 산화된 단백질의 식별을 가능하게 했다. 금속 이온 존재 하에 Aβ에 의한 ROS의 생성에 더하여, 미토콘드리아가 생성하는 ROS에 의한 미토콘드리아의 기능 장애 또한 AD의 발병과 관련이 있다. 단백질, 지질, DNA, RNA의 산화 마커들을 포함한 AD에서의 산화적 스트레스 마커들은 잘 정리되어 있다. 단백질의 산화는 특별히 AD와 가장 연관이 있는 뇌 부위인 해마와 두정엽 내의 탄화 단백질(carbonylated proteins)의 증가로 알려져 왔다. 인간의 뇌에서는 세포질 단백질 보다 막 단백질들이 산화적 손상을 더 잘 입는다. 단백질의 변화는 지질의 과산화(peroxidation) 산물인 4-hydroxynonenal (4-HNE)와의 반응에 의한 간접적인 산화나 질화(nitration)에 의해서도 일어난다. 후자의 과정은 단백질과 peroxinitrite (ONOO-; superoxide radical과 nitric oxide와의 반응 산물)의 반응에 의한 질산화적 스트레스를 야기하여 뇌 단백질들의 프로테아좀에서의 분해를 촉진한다. 지질 산화로는 4-HNE가 AD의 전형적인 조직병리학적 변화를 보여주는 해마에서 증가되어 있다는 보고가 있다. AD 뇌에서 4-HNE에 의한 lipoic acid의 변화가 관찰되었는데, 4-HNE-라이신 부가물이 신경섬유엉킴을 포함하는 신경세포뿐만 아니라, 해마 조직의 정상 대추체신경세포(pyramidal neuron)에도 분명히 존재하였다. 핵과 미토콘드리아 DNA의 산화 또한 AD에서 보고되었으며, 측두엽, 두정엽, 전두엽에서 산화된 염기들(즉, 8-oxo-2-dehydroguanine, 8-hydroxyadenine, 5-hydroxyuracil)의 수치가 증가하였다. 증상이 나타나기 전 환자의 해마에서 8-hydroxyguanine의 수치가 증가하였다. 산화적 스트레스, 특별히 산화적 DNA 손상은 가장 취약한 부위뿐만 아니라 AD의 말초 혈구세포에서도 관찰되었다. RNA의 산화는 특히 전두엽에서 mRNA의 산화가 일어났다.

2.3.2. 막의 상태와 단백질의 기능에 영향을 미치는 생체 분자 산화의 결과

AD에서 신경막의 변화는 아밀로이드를 형성하는 단백질과 막이 결합하여, 막을 가로질러 만들어지는 저중합체 구멍 구조(oligomeric pore structure)에 의해 막의 투과성이 증가되는 결과일 수 있다. 이 과정 이외에도, 산화적 스트레스 그 자체가 막의 온전성을 망가뜨리는 원인이 될 수도 있다. 예를 들면, 지질의 과산화가 시냅토좀 막의 인지질의 비대칭에 관련되어 있을 수도 있다는 것이다. 실제로, 이 비대칭은 ATP에 의존적인 효소인 aminophospholipic-translocase나 flippase에 의해 유지되는데, 이 효소들의 활성은 4-HNE에 의해 산화될 수도 있는 시스테인 잔기에 의해 조절된다. 이 지질의 과산화 물질은 몇몇 막 단백질과 결합하여 막의 구조와 기능에 변화를 일으키게 되고, 결국 AD 뇌에 신경독성을 나타내게 된다. 당 분해 및 ATP 생산에 관여하는 단백질 기능에도 문제가 생길 수 있으며, 산화 스트레스에 이차적인 이러한 뇌 에너지 대사의 장애는 AD에서 중요한 현상으로 보인다. ATP 양이 감소하게 되면 전자가 누출되게 되고, 미토콘드리아의 ROS 생성이 증가하게 되어, AD에서 또 다른 산화적 스트레스를 일으킨다. 당 대사와 ATP 합성에 직접적으로 관련되어 있는 몇몇 단백질들은 AD 뇌에서 산화에 의해 불활성화 되어 있음이 보고되었다(예를 들면, fructose biphosphate aldolase, triose phosphate isomerase, glyceraldehyde phosphate dehydrogenase, phosphoglucose mutase, enolase, pyruvate kinase). AD의 뇌에서, ATP synthase도 산화적으로 변형되어 결과적으로 불활성화 될 수 있다. 매우 초기 단계의 AD에서 이 효소의 α 서브유닛이 산화적 손상을 입는다. 진행된 단계의 AD에서는, 뇌의 ATP synthase의 활성이 감소되어 있다. 이 활성의 감소는 Aβ와 ATP synthase의 직접적인 결합과 ATP synthase 서브유닛 α의 Thr432 잔기의 O-GlcNacylation에 의한 것일 수 있다. 산화에 의한 ATP 생성에 관련된 효소의 문제는 AD에서 수송(transportation) 이상과 당 이화작용(catabolism)의 기능장애와 연관되어 있을 수도 있다. 흥미롭게도 대사 기능 장애는 AD와 당뇨가 관계가 있다는 사실에 의해 뒷받침 될 수 있다. 이에 따라, 인슐린 신호 전달과 단백질 항상성의 변화를 통해 AD의 초기 단계에서부터 mTOR(세포의 성장과 지질, 당 대사에 중요한 역할을 하는)가 비정상적으로 활성화 되어서 AD의 신경 변성에 관여되어 있다고 보고되었다. 이와 유사하게, 나이가 들어감에 따라, Aβ와 Tau에 의한 병리현상을 보이는 세 가지 유전자 이식 생쥐 모델(3xTG-AD)에서, 산화적, 질산화적 스트레스가 AD 뇌에서의 인슐린 신호 전달 장애에 영향을 미칠 것이라고 제시되었다.

산화적 스트레스는 Aβ의 제거와도 관련이 있다. Aβ가 LRP1을 산화시켜 신경 독성이 있는 Aβ를 뇌에 축적 시킨다는 가설이 있다. 실제로, LRP1은 혈액 뇌 관문을 통과하여 Aβ를 뇌에서 혈액으로 배출시키는 역할이 있고, LRP1의 활성이 AD에서 감소되어 있다. 그러므로, Aβ는 LRP1을 산화시킴으로써 자신의 제거를 저해하게 된다. LRP1 산화는 AD 해마에서 4-HNE-LRP1이 존재하는 것으로 증명되었다. 이러한 Aβ의 제거에 있어서의 변화는 뇌에 Aβ를 축적 시키고, 이는 AD 발병 여부를 결정하는 요소가 된다.

단백질 Tau 또한 AD에서 산화적 스트레스의 타겟이다. 4-HNE가 Tau의 구조를 변화시킬 수 있고, 이는 AD의 산화적 스트레스와의 연관성을 뒷받침한다. Tau의 질화(nitration) 또한 소섬유(fibril) 형성을 촉진시킬 수 있다. 이는 초기 단계의 AD에서 일어나는데, 신경섬유엉킴에 존재하는 질화된 Tau는 Tau의 엉김이 형성되기 전에 관찰되기 때문이다. 게다가, Tau는 미소관의 역동성을 조절하거나 신경의 genomic DNA, 세포질과 핵의 RNA를 ROS에 의한 손상으로부터 보호해 주는 역할을 하기 때문에, Tau의 변형은 DNA와 RNA의 산화를 증가시킬 수 있다. 어떤 이들은 DNA 복구 단백질들이 산화적 변이에 의해 불활성화될 수 있고, 이는 DNA의 절제 수복(excision repair)을 통한 DNA 손상 복구 작용의 이상을 초래할 수도 있다고 제안했다. 염기의 산화에 추가로, DNA의 산화는 신경섬유엉킴을 쉽게 만들어 신경 변성을 일으키는 DNA의 절단을 일으킬 수도 있다.

지질 뗏목(lipid raft)이라고 불리우는 콜레스테롤이 풍부한 세포막의 미세 영역의 콜레스테롤은 APP와 결합할 수 있고, 이는 APP가 인지질 단층(monolayer)에 삽입되는 것을 촉진한다. 이는 β-secretase의 활성을 유도하고, Aβ1-42를 축적시켜, 아밀로이드 형성을 쉽게 한다. 보다 정확하게는 에스테르화 콜레스테롤이 Aβ 형성을 촉진하므로, 자유 콜레스테롤과 에스테르화 콜레스테롤 사이의 균형이 아밀로이드의 생성을 조절한다. 콜레스테롤은 생체 내에서 oxysterol로 산화될 수 있는데, 이는 뇌의 과도한 콜레스테롤을 제거하는 하나의 방법이다. 뇌는 콜레스테롤을 분해하는 기능이 없으므로, 이 방식으로 콜레스테롤의 축적을 막는다. Oxysterol이 Aβ의 Lys16 잔기를 변화시킬 수 있는데, 이는 Aβ의 응집을 증가시켜 신경독성을 일으킬 수 있다. Oxysterol 중, aldo 형태로 전환될 수 있는 3β-hydroxy-5-oxo-5,6-secocholestan-6-al은 Aβ의 아민에 결합하여 Schiff base를 형성할 수 있다. 이 공유 결합에 의한 Aβ의 변화는 응집에 필요한 농도를 낮추고, 구 형태의 응집을 선호하는 점에 따라 아밀로이드 형성을 증가시킨다. 24-hydroxycholesterol이라 불리우는 또 다른 oxysterol은 cholesterol 24-hydroxylase (CYP46A1)에 의하여 뇌에서 생성되고, 혈액 뇌 관문을 통과할 수 있다. 이 oxysterol은 간의 X 수용체(LXR)에 의해 조절되는 기전을 통해 apoE를 매개로 한 콜레스테롤의 배출을 유도함으로써, 뇌의 콜레스테롤의 항상성 조절에 관련되어 있다. 이는 AD의 발병과도 연관이 있는 과정일 수 있다. 뇌에서 CYP27A1에 의해 생성되는 또 다른 oxysterol인 27-hydroxycholesterol은 혈액 뇌 관문을 통과하여 순환계에서 뇌로 이동한다. 따라서, oxysterol의 두 가지 상반되는 주요 흐름이 동시에 존재한다. 즉, 뇌로부터의 24-hydroxycholesterol과 뇌로 가는 27-hydroxycholesterol이 존재하여서, 24-hydroxy와 27-hydroxycholestero의 균형이 아밀로이드 형성에 중요할 것으로 생각된다. 27-hydroxycholesterol이 24-hydroxycholestero에 비해 증가되는 것이 AD 뇌에서 관찰되었는데, 이는 이 가설을 뒷받침하는 근거로 볼 수 있다. SH-SY5Y 세포(즉, 인간 신경아세포종 세포주이면서 고전적인 AD 병리학의 모델)에서 24-hydroxycholesterol이 APP가 아밀로이드를 생성하지 않는 방향으로 가공되는 것을 선호한다고 한다. 그럼에도 불구하고, Gamba와 동료들에 의하여 1 µM의 24-hydroxy- 혹은 27-hydroxycholesterol을 분화 후의 인간 신경아세포종 세포주(SK-N-BE)에 처리한 후, APP와 α-, β-, 그리고 γ-secretase에 대한 포괄적인 분석이 진행되었다. 이러한 상황에서, 두 종의 oxysterol은 APP의 과발현을 유도하고, β-secretase의 활성을 증가시켜 아밀로이드를 생성했다. Gamba 등과 Prasanthi 등에 의한 상반된 결과는 oxysterol의 농도(1 µM vs. 5-25 µM)와 oxysterol을 세포에 처리하는 방법과 연관이 있어 보인다. 1 µM oxysterol이 정상인과 AD 환자의 뇌 내의 oxysterol 농도와 더 가까워서 이 농도가 병리생리학적으로 좀 더 적절하다고 생각된다. 흥미롭게도, 혈장내 24-hydroxycholesterol의 양은 신경세포의 질량과 관계가 있어서 AD 환자의 뇌 위축증의 마커로 사용될 수 있다. 콜레스테롤의 자가 산화에 의해 생성되는 다른 종류의 oxysterol들도 AD 환자의 사후 뇌조직에서 관찰되었고, 이 수치는 AD의 진행 정도와 관련이 있었다.

마지막으로, 뇌에서 콜레스테롤의 주된 이동수단인 apoE의 유전자형이 산화적 스트레스에 영향을 미친다는 것을 눈여겨볼 만하다. 왜냐하면 apoε4를 지닌 AD의 혈장은 그렇지 않은 AD의 경우보다 더 많이 산화되어 있었기 때문이다. 이 유전형은 콜레스테롤의 대사와 oxysterol의 생성에 영향을 미칠 것으로 생각된다. ApoE3는 한 개의 시스테인 잔기를, apoE4는 시스테인 잔기가 없는 것에 반해, apoE2가 두 개의 시스테인 잔기를 가지고 있는 것으로 보아, apoE의 구조가 어떤 역할을 할 수도 있다. 시스테인 잔기의 개수가 적은 apoE4는 산화적 스트레스에 취약할 수 있다. ApoE의 산화는 티올(thiol)기를 매개로 하는 항산화작용에 영향을 미쳐서 지질의 과도한 산화적 손상이 일어나게 하고 Aβ의 응집을 촉진시킬 수 있다.

3. AD에서 금속의 영향

3.1. 뇌에서의 금속의 역할

다른 조직과 마찬가지로 뇌도 철, 아연, 구리, 망간, 몰리브덴, 크롬, 코발트와 같은 필수적인 d-block 금속 이온과 필수적이지 않은 금속을 함유하고 있다. 일반적으로 뇌는 단위 무게당 가장 많은 d-block 금속을 포함하고 있는 장기에 속한다. 철, 아연, 구리가 각각 kg 뇌 당 0.3, 0.1, 0.004 g 존재한다. 이 세 가지 금속 이온들이 Aβ와 산화적 스트레스와 가장 관계가 깊다. 철, 구리, 아연 이온들은 일반적으로 단백질의 활성을 조절하기 위해 단백질에 결합하여 존재한다. 아연만이 특정 지점에서 신호 전달자의 역할을 하기 위하여 단백질에 결합하지 않은 상태의 높은 농도로 존재한다. 이 이온들의 대사는 금속을 혈액으로 이동시키고, 단백질의 접힘과 성숙에 금속을 제공하고, 금속 이온을 저장하기 위해, 금속의 농도를 인지할 수 있는 것에 의해 엄격하게 조절된다. 너무 높거나 너무 낮은 농도의 금속 이온은 치명적이라고 잘 알려져 있다. 윌슨씨병과 멘키스병의 경우가 그렇다. 전자는 구리 과다, 후자는 구리 부족인 유전병이다.

3.2. AD에서의 오조정(misregulation)

AD에서 금속 이온, 특히 구리, 아연, 철이 잘 조절되지 못하고 있다는 수많은 증거가 있다. 이러한 문제가 AD의 초기 현상인지 후기 현상인지는 아직 연구가 필요하다. 잘 알려진 사실은 아밀로이드 플라크에 구리, 아연, 철이 축적되어 있다는 점이다. 흥미롭게도 인간의 아밀로이드 플라크에는 생쥐의 AD 모델의 경우보다도 높은 농도의 금속이 축적되어 있다. APP는 철에 반응하는 성분의 조절 하에 금속이 신경세포로부터 배출되는 것을 촉진한다고 알려져 있다. 게다가 APP의 전사는 구리에 의해 촉진된다고 알려져 있다. 금속의 농도, 항상성뿐만 아니라 수많은 금속 함유 단백질과 수송체들이 AD에서 영향을 받는다. 건강한 사람에 비해 인간 AD의 뇌에서는 단백질과 느슨하게 결합된 구리가 증가되어 있었다. 이러한 느슨하게 결합된 구리와 철은 산화적 스트레스를 촉진한다고 알려져 있다.

3.3. 금속과 산화적 스트레스

금속 이온 중 특히 구리, 철, 망간은 산화적 스트레스에 있어서 중요한 역할을 한다. 이들은 산화적 스트레스의 발생이나 방어에 작용한다. 자유롭거나 느슨하게 결합된 구리와 철은 ROS 생성에 있어 매우 효과적인 촉매이다. 이들은 글루타치온이나 아스코베이트와 같은 환원제에 의해 Cu(I)이나 Fe(II)로 환원된 후, dioxygen이나 H2O2와 반응하여 superoxide나 수산화 라디칼을 각각 생성한다. 반면에, 구리는 SOD1, 철은 catalase와 같은 항산화효소의 촉매 중심에 위치하고 있으면서 superoxide anion이나 H2O2를 각각 파괴한다. 이는 배위 화학의 중요성을 잘 보여준다. 구리와 철의 배위 위치에 따라 산화제 혹은 항산화제가 될 수 있다. 철과 구리의 항상성이 깨지게 되면, 자유롭거나 느슨하게 결합된 철과 구리의 농도가 상승할 수 있고, 이는 ROS의 생성을 촉진할 수 있게 된다. 이러한 구리와 철은 원래의 결합 단백질이 아닌 다른 생체 분자에 결합해서 그들의 기능을 망가뜨리고, 산화적 스트레스를 증가시킬 수도 있다.

4. Aβ와 ROS의 생성

4.1. Aβ와 금속 이온의 조화

앞에서 언급된 것처럼, 아연, 철, 구리는 뇌에 존재한다. 그것들은 시냅스에서 신경의 활성을 조절하기 위해 필요하고, 금속 함유 단백질의 기능과도 연관되어 있다. AD와 같은 몇몇 질병에서, 금속 이온의 항상성은 망가져 있고, 농도와 분포도 정상과는 다르다. 특히 구리와 아연의 농도는 정상인의 세 배까지 높아져 있다. 게다가 AD 뇌의 아밀로이드 플라크에서 이 금속 이온들이 높은 농도로 발견된다. 이들은 Aβ와 결합하므로, 둘 간의 배위 결합은 AD에서의 기능을 이해하는데 중요하다.

4.1.1. Zn(II)와 Aβ의 배위 결합

아연 이온은 Zn(II) 형태로만 존재하고 Aβ와의 배위 결합에 대해서는 잘 알려져 있지 않다. 1:1로 복합체를 형성한다고 알려져 있기는 하지만, 배위권(coordination sphere)에서 아미노산 잔기의 상태에 대해서는 여전히 의견이 분분하다. 최근에 변이가 있고, N 말단에 아세틸화 되어 있는 펩타이드와 아연의 배위 결합 모델이 NMR (Nuclear Magnetic Resonance)과 XAS (X-ray Absorption Spectroscopy) 연구에 의해서 제시되었다. Zn(II)는 6, 13, 혹은 14번 히스티딘 잔기의 이미다졸환, 11번 글루탐산, 1번 아스파르트산, 3번 글루탐산, 7번 아스파르트산의 carboxylate group과 결합하였다 (그림 4). Zn(II)의 Aβ에 대한 친화력은 ITC (isothermal calorimetry)와 경쟁 연구(competition study)를 통해 연구되었는데, affinity constant가 105 M-1이었다. 이는 아연-Aβ의 생체 내 결합을 가능케 하는 수치이다.

4.1.2. Cu(II)와 Aβ의 배위 결합

구리는 산화-환원이 활발한 이온이며, 생체 내에서 주로 Cu(I)과 Cu(II)의 두 가지 상태로 존재한다. Cu(II)의 Aβ와의 배위 결합은 수 년간 널리 연구되었고, 그 결과 pH에 따라 Cu(II)가 결합하는 형식이 다름이 밝혀졌다. 생리적 pH에서 컴포넌트 I과 II (component I and II)라고 불리우는 주요한 결합 방식은 그림 4에 정리되어 있다. 컴포넌트 I에서는 Cu(II)가 N 말단의 Asp1-Ala2에서부터 His6와 His13 혹은 His14의 이미다졸환까지 결합하는 것으로 잘 알려져 있다. 컴포넌트 II에는 서로 다른 두 가지 모델이 있다. 첫 번째 모델에서는, Cu(II)가 Ala2-Glu3에서부터 세 개의 His 잔기의 이미다졸환에 결합한다. 두 번째 모델에서는 Cu(II)가 N 말단의 Asp1의 아민기, Asp1-Ala2의 아미딜기에, Ala2의 카보닐 그룹에, 그리고 His의 이미다졸환에 결합한다. 첫 번째 모델은 비록 Cu, Zn-SOD 구조의 Cu를 연상시키기는 하지만, Cu(II)의 배위 결합 시에 탈양자화(deprotonation)되는 잔기들이 이미 모두 탈양자화되어 있기 때문에, pH가 영향을 미친다는 사실을 설명할 수 없다. 두 번째 모델에서는 Asp1-Ala2의 아마이드 기능의 탈양자화를 통해, pH7.8 근처에서 일어나는 Cu(II)의 결합 방식의 변화를 설명할 수 있다. 게다가 Electron Nuclear Double Resonance (ENDOR), hyperfine Sublevel Correlation (HYSCORE), NMR 연구는 Asp1의 N 말단과 탈양자화된 Asp1-Ala2의 아마이드 결합 둘 다 관여되어 있다고 강조함으로써, 두 번째 모델을 지지한다 (그림 4). Cu(II)와 Aβ의 결합에 대한 수많은 연구로부터, 두 종류의 친화 상수가 보고되었다. 전위차법(potentiometry)과 ITC 연구에서는 109-1010 M-1이었고, Tyr10 형광 연구에서는 107-108 M-1 이었다. Tyr10 형광 연구법에서는 inner-filter 효과가 제대로 고려되지 않아서 낮은 수치가 얻어졌다고 보고 있다. 경쟁 연구(competition study)에서도 109 M-1 범위로 나타났다.

4.1.3. Cu(I)와 Aβ의 배위 결합

Cu(I)과 Aβ의 배위 결합은 Cu(II)의 경우보다 최근에 연구되었다. 몇몇 결합 모델이 제안되었고, 그 중 두 모델이 가장 널리 알려져 있다. 첫 번째 모델은 His6, His13, 그리고 His14 사이에 활발한 교환이 일어나면서, His가 Cu(I)과 일렬로 결합하는 것이다. 두 번째 모델은 His 한 쌍과 His 잔기 세 개가 Cu(I)와의 배위 결합에서 평형을 이루는 것이다. NMR 연구는 제안된 두 모델에 따라, 활발한 교환을 통한 Cu(I)의 배위 결합에 있어서 세 개 히스티딘 잔기의 의미를 보여주었다. 그러나 XAS 연구와 Cu(I)과 His-His dipeptide의 결합체와 Cu(I)과 Aβ6-14와 Aβ10-14와의 결합체의 비교로부터 2개의 히스티딘 잔기와의 일렬 결합이 확인되었다. 덧붙여서 Cu(I)-Aβ 구조에 대한 tandem mass spectrometry 연구에서 Cu(I)의 배위 결합에 관여되는 두 개의 히스티딘 잔기가 His13과 His14라는 것이 밝혀졌다. 그러므로, Aβ가 Cu(I)에 His6, His13, His14, 특히 His13과 His14 잔기를 통해 일렬로 결합한다고 보여진다 (그림 4). 이는 Aβ의 His-Ala 변이(H6A, H13A, H14A)체와 Cu(I) 사이의 친화도 연구와도 일맥상통한다. 이들 변이체는 정상 펩타이드에 비해 약간 낮은 친화도를 보이며, H6A가 다른 두 변이체보다는 강한 친화도를 보였다. 이러한 결과들은 Aβ가 Cu(I)과 결합하는데, 단지 두 개의 히스티딘 잔기, 주로 His13-His14만 필요함을 의미한다. Cu(I)과 Aβ의 친화도에 대해 세 가지의 연구가 행해졌는데, 각각 1015 M-1, 1010.4 M-1, 107 M-1과 같이 모두 다른 친화 상수를 얻었다.

4.1.4. Fe(II)와 Aβ의 배위 결합

주로 Fe(II)와 Fe(III)의 경우인 철과 Aβ의 배위 결합 연구는 극소수에 불과하다. 생리적 pH에서 Fe(III)는 매우 안정한 Fe(III)(OH)3 침전을 형성하므로, Aβ의 결합은 불가능하다. Fe(II)와 Aβ의 배위 결합에 대한 연구는 단 한 건이 있는데, 1H, 13C, 2D NMR를 이용하였고, Asp1, Glu3, 세 개의 His가 관여된다고 한다. Cu(II)-Aβ의 component I NMR 데이터와 Fe(II)-Aβ의 NMR 데이터를 비교해서 선호되는 배위 결합 상태가 제안되었다 (그림 4). Fe(II)-Aβ 결합에 His13이나 His14뿐만 아니라, Asp1의 말단 아민과 카르복실 그룹, Asp1-Ala2와 His6-Asp7C=O 펩타이드 결합, His6의 이미다졸환이 연관되어 있음이 보고되었다.

4.2. Aβ-금속에 의한 ROS 생성

구리와 철과 같은 산화-환원이 활발한 금속 이온들은 ROS의 생성에 관련되어 있다고 알려져 있다. 환원제의 존재 하에, 이 금속들은 두 가지의 산화-환원 상태를 순환하면서 촉매 활성을 갖게 된다. 구리와 철은 Aβ와 결합할 수 있으며, 이는 ROS 생성에 연관되어 AD와 산화적 스트레스와의 직접적인 연결고리가 된다. Fe-Aβ는 낮은 산화환원 활성을 갖기 때문에, ROS 생성은 주로 Cu-Aβ를통해 연구되어 왔다. 철은 아밀로이드 플라크에서 주로 콜로이드 형태로 발견되었으나, 조직화학적(histochemical) 연구에서 철이 Aβ와 결합할 수 있음이 보고되었다. Fe(II)와 Aβ의 결합 상태는 밝혀졌으나 (그림 4), Fe(III)는 Fe(III)(HO)3 침전을 형성하므로 Aβ와의 복합체를 형성하지 못한다. 그러나 Fe(II)-Aβ 복합체가 안정적이고, ROS 생산 중에 형성된 Fe(III) 복합체는 침전될 시간이 없기 때문에, Fe-Aβ에 의한 ROS 생성은 여전히 가능성이 있다. 이 리뷰에서는 Cu-Aβ 복합체에 대해서만 집중하기로 한다.

Cu-Aβ 복합체의 경우, 관련 Cu-펩타이드 또는 Cu-단백질 복합체 보다는 ROS 생산이 더 활발하지만, 버퍼의 구리보다는 효율이 낮기 때문에, Cu-Aβ 시스템의 산화제로서의 역할이 명확히 확립되지 않았다. 생물학에서 구리는 보통 생체 분자와 결합되어 있기 때문에, 후자의 경우는 생물학적으로 적절하지 않다. 체외 연구에서 Cu-Aβ는 O2 존재 하에 H2O2와 HO의 생성과 아스코르브산염의 생성을 촉매할 수 있다 (그림 5a). Cu-Aβ에 의한 H2O2의 생성은 일반적으로 두 개의 전자 프로세스를 통해 일어난다고 제시되었으나, 최근의 연구에서는 Cu-Aβ와 O2에 의해 H2O2가 생성될 때 중간 산물로 과산화물(superoxide)이 생성된다고 밝히고 있다.

구리는 산화-환원이 활발하고, Aβ와 결합되었을 때, +I과 +II의 산화 상태를 순환한다. 전기화학 연구는 Cu(II)와 Cu(I)의 결합 영역이 매우 다르기 때문에, Cu(I)의 산화 또는 Cu(II)의 환원을 위해 전자가 전달될 수 있도록 하기 위해서는 미리 조직된 메커니즘이 필요하다고 한다 (그림 5b). Cu(I)와 Cu(II) 기하학적 구조(각각 선형 및 평방 평면) 사이의 재배열에 필요한 에너지는 매우 높기 때문에, 전자 전송은 오히려 Cu(I)와 Cu(II)의 결합 모드가 매우 유사한 저밀도 산화-환원을 만족할 만한 상태를 통해 진행되며, 따라서 낮은 재구성 에너지를 유도한다. 전기화학적으로 in-between 상태라고 불리우는 이 일시적인 상태는 휴지기와 평형을 이루며, 용액 중에서 전체의 1/1000을 차지한다.

금속의 촉매 작용에 의한 ROS 생성 중의 전자의 이동도 in-between 상태와 비슷한 상태를 통해 일어난다고 알려져 왔다. 컴퓨터를 이용하여 기질(O2 혹은 H2O2)에 대한 반응성뿐만 아니라 그 상태의 구리 환경에 대해 연구를 하였다. 펩타이드 중 산화적 손상을 입는 부위는 금속 촉매에 의한 ROS 생성 과정에서 산화되는 부위이기 때문에, 이를 규명하기 위하여 MS/MS를 이용한 in-between 상태와 관련된 아미노산 잔기의 상태를 연구해 왔다. 방사선 조사에 의한 ROS 생성 후에 Aβ28에 비특이적으로 일어나는 산화와 구리를 매개로 하는 Aβ28의 산화를 비교함으로써, Asp1, His13, His14가 금속 특이적인 타겟임이 밝혀졌다. 게다가 구리를 매개한 Aβ28 산화의 반응속도론적 연구를 통해, Asp1이 손상을 입는 첫 번째 아미노산임이 밝혀졌다. 그러므로 이 논문에서는 in-between 상태에서 Cu(II)와 Cu(I)의 배위 결합 리간드는 Asp1, His13, His14임을 제안한다. 이들은 HO의 주요 타겟으로 밝혀졌기 때문에, 금속을 촉매로 하는 ROS의 생성 과정 중, 이들 아미노산 잔기들이 구리와 가장 가까이 위치 하리라 생각된다. 유사한 연구가 전장(full-length) Aβ40을 가지고 행해 졌는데, 같은 결론을 얻었다.

마지막으로, 최근 논문에서 형광과 UV-Vis에 기반한 방법을 통하여, Cu와 결합하는 다양한 종류의 변형된 펩타이드에 의한 ROS 생성에 대한 평가에서 ROS 생성에 관련된 in-between 상태의 Cu-Aβ 복합체 상태를 제안했다. 히스티딘의 이미다졸 그룹뿐만 아니라, 말단의 아민, Asp1의 카르복실기가 Cu(I)과 Cu(II)의 결합 영역과 관련이 있어서 최소의 재배치 에너지를 가진 전자 이동을 일으킨다고 제시되었다 (그림 5b).

5. Aβ에 의한 산화적 손상

5.1. 체외에서의 금속 촉매에 의한 산화(metal-catalyzed oxidation, MCO) 과정 중, Aβ 잔기의 손상

ROS는 산소의 불완전한 환원으로부터 생성되는 라디칼이다. ROS는 체내에서 H2O가 생성되는 과정 중, O2의 환원이 네 번 진행되는 동안 소량 발생한다. 이는 세포의 항상성을 유지하거나 신호 전달에 있어 중요한 역할을 한다. 그러나 활성이 높은 산화제들은 생체 분자에 손상을 입힐 수 있다. 세포 내에서는 항산화적 방어를 하는 효소들이 ROS에 의한 손상을 막는다. Dioxygen의 1개 전자의 환원에 의해 생성되는 superoxide (O2•–)가 불활성화 시킬 수 있는 효소는 거의 없고, 낮은 속도 상수(보통 102 Lmol-1s-1) 때문에, 대부분의 생무기 분자와 낮은 반응성을 가지고 있다. H2O2는 superoxide의 1개 전자의 환원에 의해 생성된다. 이는 티올기(thiol group)를 가지고 있는 단백질을 산화시킬 수 있고, 철이나 구리와 같은 산화-환원 작용이 활발한 금속 이온과 함께 존재할 때는 Fenton이나 Haber-Weiss 반응을 통해 수산화 라디칼을 생성할 수 있어 해롭다. H2O2는 체내에서 두 개의 효소(catalase, glutathione peroxidase)에 의해 조절된다. 수산화 라디칼(HO)은 산소의 세 번째 전자 한 개에 의한 환원에 의해 생성되거나 금속 이온 존재 하에 H2O2로부터 생성될 수도 있다. HO는 O2•– (10-6 s)에 비해 매우 짧은 반감기를 가지고 있고, 높은 redox potential (E˚’= 2.34 V)을 가지고 있기 때문에, 단백질, 지질, DNA와 같은 생체 분자를 산화시킬 수 있는 더욱 활동성이 크고 유해한 ROS이다. ROS의 양을 조절하고, 생체분자의 손상을 막기 위해 신체는 효소적, 화학적 항산화제 기전을 가지고 있다. 그러나 AD와 같은 일부 질병에서는 ROS 생성이 높거나, ROS를 제거하는 효소 활성이 떨어져 산화제와 항산화제의 불균형이 일어날 수 있다.

금속 촉매를 통한 ROS의 생성 과정 중에 Aβ가 산화적 손상을 입는다. 이는 산화된 Aβ가 아밀로이드 플라크에서 발견되는 것과 일맥상통한다. 단일 아미노산 잔기의 산화에 대한 연구가 Aβ의 MCO 과정 중의 타겟 잔기 예상을 가능케 했다. HO·의 주요 타겟은 황을 포함한 아미노산(메티오닌, 시스테인), 염기성 아미노산(알기닌, 히스티딘, 라이신), 그리고 아로마틱 아미노산(페닐알라닌, 티로신, 트립토판)이다. 표 1은 이러한 아미노산들의 산화물을 보여준다. G-radiolysis에 의해 생성된 HO·에 의한 Aβ28의 산화는 His와 Phe가 주요 타겟임이 밝혀졌다. 그러나 Aβ의 MCO의 경우에는 ROS가 금속의 중심부에서 생성된다. 그러므로 이러한 산화는 위치 특이적이고, 금속 이온 없이 일어나는 아미노산의 산화와는 다를 수 있다.

 

표 1. HO의 공격에 의한 아미노산의 주요 산화 결과물
upload_image

 

5.1.1. 아스파르트산의 산화

Aβ는 1, 7, 23번 위치에 세 개의 아스파르트산을 가지고 있다. 문헌에 따르면 MCO 과정 중, 1번 아스파르트산만이 산화된다. Asp1은 Cu(II)의 안정 상태와 결합하고 있으며, ROS 생성 과정 중의 구리 영역에 관련되어 있다고 알려져 있다. 그러므로 금속 중심에서 생성되는 수산화 라디칼이 선호하는 타겟이 될 수 있다. Asp1의 MCO 동안 아스코르베이트나 H2O2의 존재 하에, 몇몇 산화적 손상이 관찰되었다. 그림 6a는 알코실 라디칼의 형성을 통해 피루브산염, 이소시아산염 또는 2-하이드록시아스파테이트의 형성을 유도하는 산화 메커니즘을 요약하고 있다. Asp1의 산화에 작용하는 피루브산염의 형성은 이미 Aβ의 MCO 과정 중에 관찰되었고, 이는 α-amidation 경로를 통해 진행된다. 중간 산물인 알코실 라디칼은 hydroperoxyl radical (HO2)이 관여될 수도 있는 반응에 의한 수산화물에 의해 생성된다. Asp1은 펩타이드 결합의 α 위치의 backbone 절단이 일어나서, diamine 경로를 거쳐 일어나는 반응 메커니즘에서 isocyanate의 기능을 유도하기도 한다. Asp1은 MCO에 의해 2-hydroxyaspartate로 변환되기도 한다.

5.1.2. 히스티딘의 산화

Aβ는 6, 13, 14번 위치에 세 개의 히스티딘을 가지고 있다. 이들의 이미다졸환은 Cu(II)와 Cu(I)의 안정 상태와 결합하고 있으며, ROS 생성 과정 중의 구리 영역에 관련되어 있다고 알려져 있다. 히스티딘은 아스코르브산 존재 하에, 구리와 결합한 Aβ의 MCO 과정 중, 2-oxohistidine으로 산화된다 (그림 6b). HO에 의한 히스티딘 산화 반응은 이미다졸환의 C-2 위치의 공격으로부터 시작된다 (그림 6b). 이렇게 생성된 hydroxyhistidinyl radical은 Cu(II)와의 반응을 거쳐 2-oxohistidine으로 더 산화 되게 된다. His6는 산화된 형태로 발견되지 않으며, 더 오랜 산화 시간에 의해 영향을 받는데 반해, His13과 His14는 산화에 더욱 민감한 것으로 밝혀졌다. His13과 His14는 dehydrooxohistidine으로 변환되는 것이 알려져 있다.

5.1.3. 페닐알라닌의 산화

Aβ는 4, 19, 20번 위치에 세 개의 페닐알라닌을 가지고 있다. 이들 중 어느 것도 Cu(II)나 Cu(I)과 결합하고 있지 않지만, Phe19와 Phe20은 Cu(II)와 아스코르브산의 존재 하에서의 Aβ의 MCO 동안 산화 된다고 알려져 있다. Phe19와 Phe20은 산소 원자가 추가된 형태인 hydroxyphenylalanine 형태로 관찰되었다 (그림 6c). 이는 구리와의 결합에 관여하는 Asp1의 산화 후에 일어나는 것으로 생각된다.

5.1.4. 티로신의 산화

구리와의 결합에 관여되는 아미노산들이 산화에 더 취약하지만, 결합에 관여되지 않는 아미노산들도 산화될 수 있다. Tyr10이 바로 그러한 아미노산인데, 이는 Aβ가 dityrosine 결합을 형성하는데 역할을 한다 (그림 6d). 이 반응은 H2O2의 존재 하에 Cu(II)에 의해 Aβ에서 일어나는 반응이다. Aβ의 결합이 공유결합을 통한 올리고머의 형성과 관련이 있기 때문에, MCO를 통한 Tyr10의 dityrosine으로의 변화는 단백질 뭉침 현상에 영향을 주는 것으로 알려졌다. 게다가 Tyr10은 Cu(II)가 Cu(I)로 환원되도록 Met35로부터 전자를 전달해 주는 것을 촉진하는 관문으로도 제시되었다. 그러나 이는 몇몇 그룹에서 보고한 바 있는 Cu(II)-Aβ의 안정성과 모순된다.

5.1.5. 메티오닌의 산화

메티오닌은 산화에 매우 민감한 아미노산이다. 생체 내에서는 메티오닌의 주요한 산화 형태인 methionine sulfoxide를 methionine sulfoxide reductase가 환원시킨다 (그림 6e). 메티오닌은 또한 전자 1개에 의한 산화에 의하여 sulfuranyl/hydroxydulfuranyl radical cation으로 변환될 수 있다. 한 리뷰 논문은 Aβ 펩타이드의 35번 메티오닌의 산화와 이것의 독성과 산화적 스트레스에서의 기능에 대해 다루고 있다. 비록 메티오닌이 산화에 매우 민감하지만, 이는 구리와 아스코르브산의 존재 하에 Aβ의 MCO과정 중에 일어나는 His13과 His14의 산화 후에만 일어난다. 이는 결합한 구리에 의해 촉매 되는 아미노산의 산화에 있어서 위치 특이성을 강조하는 것이다. 또한 Met35는 Tyr10의 산화를 촉진하고, Gly33와 결합하여 carbon-centered radical의 형성을 촉진함으로써 Gly33의 과산화를 일으킨다고 알려져 있다. 그림 6f는 수산화 라디칼에 의한 H 제거 후의 hydroperoxide 형성 메커니즘을 보여준다. Met35의 산화에 의해 생성된 sulfuranyl radical은 (그림 6e) 유사한 H 제거 반응을 일으킬 수 있다.

5.1.6. 기타 절단

H2O2 존재 하에, Cu(II)와 결합한 Aβ의 Asp1/Ala2, Ala2/Glu3, Val12/His13, His13/His14 펩타이드 결합의 산화적 절단이 보고된 바 있다.

5.2. 생체내 Aβ 산화의 특징

AD의 원인을 밝히는데 있어서 생체 시료의 Aβ의 성질을 연구하는 것은 매우 중요하다. 생체 외에서 얻어진 결과와의 관련성을 알아보기 위해서도 필수적이다. 그러나 이는 초기부터 도전적인 과정이었다. 생체 시료의 복잡성(뇌척수액, 뇌조직, 혈청), Aβ의 적은 양, 펩타이드의 특정 생리화학적 성질(엉기거나 다른 단백질과 결합하거나 시험관 표면에 흡착하려는 경향 등)이 연구를 매우 힘들게 만든다. 게다가 최종 목표가 Aβ 펩타이드에 의해 일어난 산화적 손상의 규명일 경우에는 더욱 어렵다. 첫째, 생체 시료 중의 산화된 Aβ의 양은 매우 적다. 둘째, 산화적 변화가 시료의 정제 과정이나 분석 과정 중에 일어날 수 있다. 예를 들자면, 메티오닌의 산화가 그렇다. 이러한 문제를 피하기 위해 여러 대조군 샘플이 필요하다.

생물학적 시료로부터 Aβ를 정제하고 분석하기 위해, 전기 영동, 면역학적 분석, 그리고 mass spectrometry (MS)와 함께 면역침강법(immunoprecipitation)과 같은 방법이 주로 사용된다. Aβ는 주로 6E10, 6C3(둘 다 epitope이 N 말단), 4G8 (epitope이 Aβ의 18-22에 존재)과 같은 항체를 이용해 얻는다. 다양한 아미노산 서열을 가진 Aβ를 얻기 위해 같은 시료에 대해 여러 항체가 사용되기도 한다. 앞서 말한 바와 같이 얻어진 펩타이드의 분석은 대개 젤 기반 또는 MS 기반 기법으로 이루어지며, Näslund와 동료들이 Aβ1–40의 메티오닌 황산화물(MetO)이 노인성 반점에 풍부하다는 것을 발견한 것은 후자의 전략에 따른 것이었다. 그들은 MetO와 같이 +16 질량을 나타내는 종류들을 찾아낼 수 있었다. 최근에 Portelius와 동료들이 6E10, 4G8, 11A50-B10 (epitope이 C 말단) 항체를 이용하여 면역침강법을 시행하고, MS 분석을 통해 35번 위치의 MetO가 CSF에 존재함을 보임으로써 이전의 결과를 재확인하였다. 생체 외 연구 결과와 함께, Met35의 산화가 Aβ 에 의한 신경독성에서의 역할이 J20 생쥐(AD 모델 생쥐, Met35가 Leu로 치환되어 있는 Aβ1-42를 과발현하는 transgenice mouse)에서 보고되었다. 이전에는 산화된 Aβ의 분석 방법으로 면역분석이 주를 이루었으나, 최근 들어 MS 기반의 분석으로 발전함으로써 분석 방법의 한계가 많이 극복 되리라 생각된다.

6. 전망과 앞으로의 연구

AD의 중요한 특징은 신경세포의 지질과 단백질에 산화적 손상이 존재한다는 것인데, 이것은 분명히 산화적 스트레스와 AD가 관련이 있다는 의미이다. 산화적 스트레스는 경미한 인지 손상 뇌 부위에 산화 마커가 나타나기 때문에 AD에서 초기에 일어나는 현상일 수 있다. ROS의 생성 기원은 다를 수 있지만, ROS의 과도한 생성이 주요한 영향을 미치는 것으로 간주되고 있다. 구리나 철과 같이 느슨하게 결합한 금속 이온들은 ROS 생성에 있어서 매우 효율적인 촉매이며, 느슨하게 결합한 구리의 양이 AD에서 증가된다고 보고되었다. Aβ에 결합한 구리 이온은 AD에서 관찰되는 산화적 스트레스에 기여할 수도 있다.

최근의 연구는 Aβ 자체의 산화적 손상과 ROS를 생성하기 위해 금속 이온과 결합하는 방식에 초점이 맞춰져 있다. 첫 번째 관심은 주변 분자들과 Aβ 자체에 대한 ROS 공격의 결과에 대한 이해에 있다. 후자의 경우, 산화적 손상은 산화된 Aβ에 의한 ROS 생산과 Aβ의 응집에 영향을 미치는 금속 이온 결합에 영향을 미칠 수 있다. 산화된 Aβ는 Aβ1-42가 β-sheet이 풍부한 소섬유(fibril)를 형성하는 것을 막는다고 보고되었다. 우리 연구실에서는 Aβ의 MCO가 뭉침 과정에 미치는 영향과 산화가 소섬유 보다 더 독성이 강하다고 알려진 작은 올리고머들의 형성을 돕는지에 대한 가능성에 주목하고 있다. Aβ의 MCO 과정 중에 구리의 재배치 또한 ROS 생성을 촉진한다고 알려졌다. 또 다른 연구 방법은 AD와 관련된 ROS 생성 메커니즘에 대한 지식을 기반으로, AD에 맞서 싸울 혁신적인 치료 전략을 개발할 가능성에 달려있다. 최근까지 설득력 있는 결과를 내지는 못했지만, Cu(II)에 의한 ROS의 생성을 막는 킬레이트 분자의 개발에 많은 연구를 해 왔다. AD를 치료하기 위한 직접적인 구리 이온의 킬레이션에 대해서는 여전히 의견이 분분하다. 새로운 접근법들 중 일부는 아연이 뇌에 높은 농도로 존재하고 있으므로, 킬레이팅 방법에 구리와 함께 아연을 포함하고 있다. 동시에 Aβ의 엉김을 막는 항체 기반 치료 전략이 새로이 떠오르고 있으며 유망해 보인다.

 

  추천 1
  
인쇄하기 주소복사 트위터 공유 페이스북 공유 
  
본 게시물의 무단 복제 및 배포를 금하며, 일부 내용 인용시 출처를 밝혀야 합니다.
Citation 복사
김희정(2019). 알츠하이머병에서의 산화적 스트레스와 아밀로이드 베타 펩타이드. BRIC View 2019-R25. Available from https://www.ibric.org/myboard/read.php?Board=report&id=3323 (Oct 01, 2019)
* 자료열람안내 본 내용은 BRIC에서 추가적인 검증과정을 거친 정보가 아님을 밝힙니다. 내용 중 잘못된 사실 전달 또는 오역 등이 있을 시 BRIC으로 연락(member@ibric.org) 바랍니다.
 
  댓글 0
등록
목록
한양대학교
위로가기
동향 홈  |  동향FAQ  |  동향 문의 및 제안
 |  BRIC소개  |  이용안내  |  이용약관  |  개인정보처리방침  |  이메일무단수집거부
Copyright © BRIC. All rights reserved.  |  문의 member@ibric.org
트위터 트위터    페이스북 페이스북   유튜브 유튜브    RSS서비스 RSS
머크