[DEBUG-WINDOW 처리영역 보기]
즐겨찾기  |  뉴스레터  |  오늘의 정보  |  e브릭몰e브릭몰 회원가입   로그인
BRIC홈 Bio마켓
제품평가단 모집
스폰서배너광고 안내  배너1 배너2 배너3 배너4
LABox-과학으로 본 코로나19 (COVID-19)
전체보기 할인행사 시약벤더 제품평가 기업정보 BRIC인증마크
 
조회 27  인쇄하기 주소복사 트위터 공유 페이스북 공유 
[모아바이오] [CUSABIO] 500,000가지 이상의 Recombinant Proteins 제품들!
제품(기술)분류: 시약 > 기타
전화: 02-406-2942
메일: info(at).morebio.co.kr
팩스: 031-735-2944

확대보기
상세정보 사용후기 회사정보 |  등록제품 |  시약벤더 |  진행중 이벤트
  카탈로그 NO :
  제품 생산일 : 년도 선택.월 선택
  원산지 :
  생산기업 : Cusabio
  특징 및 규격  

upload_image

* CUSABIO는 500,000개 이상의 Recombinant Proteins를 취급합니다!

위 로고를 클릭하여 모든 종류의 Recombinant Proteins을 확인해보세요 :)

 


 

 

Recombinant Human Endophilin-A2(SH3GL1)

 

Code CSB-EP859949HUb0
Size

10ug, 100ug

Image

SDS-PAGE- Recombinant protein Human SH3GL1

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

 

Product Details

 

Purity Greater than 85% as determined by SDS-PAGE.
Target Names SH3GL1
Uniprot No. Q99961
Research Area Cell Biology
Species Homo sapiens (Human)
Source E.coli
Expression Region 1-368aa
Target Protein Sequence

MSVAGLKKQFYKASQLVSEKVGGAEGTKLDDDFKEMEKKVDVTSKAVTEVLARTIEYLQPNPASRAKLTM

LNTVSKIRGQVKNPGYPQSEGLLGECMIRHGKELGGESNFGDALLDAGESMKRLAEVKDSLDIEVKQNFID

PLQNLCEKDLKEIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFEESKEVAETSMHNLLETDIEQVS

QLSALVDAQLDYHRQAVQILDELAEKLKRRMREASSRPKREYKPKPREPFDLGEPEQSNGGFPCTTAPKIA

ASSSFRSSDKPIRTPSRSMPPLDQPSCKALYDFEPENDGELGFHEGDVITLTNQIDENWYEGMLDGQSGF

FPLSYVEVLVPLPQ


Note: The complete sequence including tag sequence, target protein sequence and

linker sequence could be provided upon request.

Mol. Weight 45.0 kDa
Protein Length Full Length
Tag Info N-terminal 10xHis-tagged
Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.


Note: If you have any special requirement for the glycerol content, please remark when you place the order.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

 


 

인기 Recombinant Proteins!

 

Recombinant Staphylococcus aureus Acyl carrier protein(acpP)

Express system: Yeast

Species: Staphylococcus aureus (strain Mu50 / ATCC 700699)

Recombinant Bacillus subtilis Uncharacterized protein YuaB(yuaB) (Active)

Express system: in vitro E.coli expression system

Species: Bacillus subtilis (strain 168)

Recombinant Human Atrial natriuretic peptide receptor 1(NPR1),partial

Express system: E.coli

Species: Homo sapiens (Human)

Recombinant Human Nuclear transcription factor Y subunit beta(NFYB)

Express system: E.coli

Species: Homo sapiens (Human)

Recombinant Bovine T-cell surface glycoprotein CD8 alpha chain(CD8A),partial

Express system: Yeast

Species: Bos taurus (Bovine)

Recombinant Human 5-formyltetrahydrofolate cyclo-ligase(MTHFS)

Express system: E.coli

Species: Homo sapiens (Human)

 

 


 

upload_image

사용후기
작성자*
내용*
만족도*
이화여자대학교
할인행사 광고 할인행사 광고
케이비티
에펜도르프코리아 Stirrer, Dry Bath, Shaking Incubator, Thermo Shake...
에펜도르프코리아
에펜도르프코리아 Eppendorf 2020 상반기 프로모션 안내 : 실험실 필수품 피펫,원심분리기,PCR장...
위로가기
Bio마켓 홈  |  Bio마켓FAQ  |  Bio마켓 문의 및 제안
 |  BRIC소개  |  이용안내  |  이용약관  |  개인정보처리방침  |  이메일무단수집거부
Copyright © BRIC. All rights reserved.  |  문의 member@ibric.org
트위터 트위터    페이스북 페이스북   유튜브 유튜브    RSS서비스 RSS
에펜도르프코리아