[DEBUG-WINDOW 처리영역 보기]
즐겨찾기  |  뉴스레터  |  오늘의 정보  |  e브릭몰e브릭몰 회원가입   로그인
BRIC홈 Bio마켓
2019 Bio Top5 인터뷰
스폰서배너광고 안내  배너1
전체보기 할인행사 시약벤더 제품평가 기업정보 BRIC인증마크
 
조회 107  인쇄하기 주소복사 트위터 공유 페이스북 공유 
[휴바이오랩] [Cusabio] Recombinant Human Repulsive guidance mol
제품(기술)분류: 시약 > Antibody
전화: 01094687169
메일: hubiolab(at).gmail.com
팩스: 07079661691

확대보기
상세정보 사용후기 회사정보 |  등록제품 |  시약벤더
  카탈로그 NO : CSB-BP836186HUd8
  제품 생산일 : 년도 선택.월 선택
  원산지 : 미국
  생산기업 : Cusabio
  특징 및 규격  

[Cusabio] Recombinant Human Repulsive guidance molecule A(RGMA)

Cusabio Life Science – Your Biology Science Partner

Code

CSB-BP836186HUd8

Product Details

Purity Greater than 85% as determined by SDS-PAGE.
Target Names RGMA
Uniprot No. Q96B86
Research Area Neuroscience
Species Homo sapiens (Human)
Source Baculovirus
Expression Region 169-424aa
Target Protein Sequence PHLRTFTDRFQTCKVQGAWPLIDNNYLNVQVTNTPVLPGSAATATSKLTIIFKNFQECVDQKVYQAEMDELPAAFVDGSKNGGDKHGANSLKITEKVSGQHVEIQAKYIGTTIVVRQVGRYLTFAVRMPEEVVNAVEDWDSQGLYLCLRGCPLNQQIDFQAFHTNAEGTGARRLAAASPAPTAPETFPYETAVAKCKEKLPVEDLYYQACVFDLLTTGDVNFTLAAYYALEDVKMLHSNKDKLHLYERTRDLPGRA
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 72.5 kDa
Protein Length Full Length of Mature Protein
Tag Info N-terminal MBP-tagged and C-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA Please contact us to get it.
사용후기
작성자*
내용*
만족도*
라이브셀인스트루먼트
제품평가 공지사항
수입 외산제품 제품평가를 시작합니다.
할인행사 광고 할인행사 광고
코람바이오텍
에펜도르프코리아 [OriGene] IHC Reagents, shRNA, CRISPR, Proteins, L...
에펜도르프코리아
에펜도르프코리아 Eppendorf New 25mL Conical Tubes : 혁신적인 디자인과 다양하고...
위로가기
Bio마켓 홈  |  Bio마켓FAQ  |  Bio마켓 문의 및 제안
 |  BRIC소개  |  이용안내  |  이용약관  |  개인정보처리방침  |  이메일무단수집거부
Copyright © BRIC. All rights reserved.  |  문의 member@ibric.org
트위터 트위터    페이스북 페이스북   유튜브 유튜브    RSS서비스 RSS
에펜도르프코리아