[DEBUG-WINDOW 처리영역 보기]
즐겨찾기  |  뉴스레터  |  오늘의 정보  |  e브릭몰e브릭몰 sale 회원가입   로그인
BRIC홈 실험
검색광고안내
시마즈(SHIMADZU) 제작소 탐방기 - 1편
스폰서배너광고 안내  배너1 배너2 배너3 배너4
과학으로 본 코로나19 (COVID-19)
전체보기 안전점검 논문교환 LABox
 전체 > Molecular Biology-Protein > Western Blot Analysis
조회 253  스크랩 인쇄하기 주소복사 트위터 공유 페이스북 공유 
질문 His fusion 공벡터 pull down 후 western blot 시에 검정 안 됨
올챙이Olajucan(대학원생)  | 08.14 21:21

안녕하세요.

His fusion vector와 MBP fusion vector를 이용하여 pull-down 실험을 수행중입니다.

His-goi와 control로 사용하기 위해 His 공벡터를 각각 발현하여 His-resin에 붙이고 MBP-goi를 발현하여 binding 후에 elution 하였습니다.

문제는 Anti-His 항체로 western blot시에 His-goi는 검출이 되나 His는 전혀 검출이 되지 않습니다.

젤을 CBB staining해보면 band가 뚜렷이 나오고,

transfer 시에 His 위치(18 kDa)에 해당하는 pre-stained marker가 뚜렷이 membrane에 붙는것으로 보아 문제가 없지 않을까 생각됩니다.

(참고로 over-transfer를 방지하기 위해 SDS를 뺀 transfer buffer를 사용하여 100V, 30분 transfer 하였습니다.)

제 실험과정에 문제가 있다고 생각되는 부분이 있으시다면 조언 부탁드립니다.

감사합니다.

#His 정제
 
#pull down
 
#His 공벡터
답변하기
답변 본 정보는 네티즌에 의해 작성된 정보로, 내용 중 중요하다고 생각되는 부분은 추가적인 사실 확인을 반드시 하시길 바랍니다.
대왕개구리SPEED  |  08.14 22:01  

His 공벡터는 어떤건가요?

올챙이Olajucan  |  08.14 22:07  
pET His Mocr TEV cloning vector입니다.
https://www.addgene.org/29658/
대왕개구리SPEED  |  08.14 22:20  

공벡터에서 His가 발현되나요?

올챙이Olajucan  |  08.15 07:40  
PolyHis site가 RBS 뒤에 위치하고 있고, His resin binding 후에 elution하면 유전자가 삽입되지 않았을 시에 예측되는 단백질 사이즈를 CBB staining시 관찰할 수 있어서 그렇게 생각하였습니다.
대왕개구리SPEED  |  08.15 11:23  

HIS가 생산될 ORF가 형성되지 않습니다.

올챙이Olajucan  |  08.15 11:42  
첨부파일 파일첨부: 그림1.png (107 KB)
이미지 첨부파일

SPEED님,

첨부를 보시면 rbs뒤에 start codon이 있고 다음과 같이 translation이 되는데,

이는 ORF 형성과는 상관없는 것인가요?

FCLTLRRRYTMGSSHHHHHHGSSMSNMTYNNVFDHAYEMLKENIRYDDIRDTDDLHDAIHMAADNAVPHYYADIRSVMASEGIDLEFEDSGLMPDTKDDIRILQARIYEQLTIDLWEDAEDLLNEYLEEVEEYEEDEEGTGIEENLYFQSNIGSG*RIRI

지식이 부족하여 설명해주시면 감사드리겠습니다.

대왕개구리SPEED  |  08.15 12:08  

다시 계산해 보니 사용한  벡터에서 His에서 TEV 까지 발현이 될것 같습니다.

vector가 없는 host와 vector가 있는 host 간 비교했을 때 HIS-TEV 사이의

141 아미노산은 정확히 발현이 되나요?

올챙이Olajucan  |  08.15 12:47  
첨부파일 파일첨부: 그림2.png (591 KB)
이미지 첨부파일

vector가 없는 host와는 비교해 보지 않았고,

His공벡터와 His-goi가 삽입된 것만 비교해보았습니다.


첨부사진을 보시면 왼쪽은 발현 뒤 His-Resin에 binding한 뒤 flow-through를 내린 것이고, 오른쪽은 MBP-goi binding, elution한 것을 내린 것입니다.

말씀해주신 141aa가 MW prediction을 했을 때 18kDa가 나왔고, elution 뒤에 band가 강하게 나와서 맞는 것으로 생각했습니다.

공벡터 발현 뒤 soluble fraction을 내려도 저 사이즈가 나왔습니다.

 

대왕개구리SPEED  |  08.15 12:55  

host, host + vector를 동일한 방법으로 유도한 후 lysate를 비교하는 것은

필요합니다.

오른쪽 gel의 낮은 band 3개 lane은 뭔가요?

전기영동 gel의 설명은 우선 gel에 lane별로 표시를 하는 것이 이해하기 쉽습니다.

올챙이Olajucan  |  08.15 14:51  
host도 확인해 보겠습니다.
오른쪽 그림의 왼쪽 3개 lane은 His 공벡터와 MBP태깅된 타겟 단백질 각각을 붙인뒤 elution한 것이고,
오른쪽 3개 lane은 His-goi와 타겟 단백질 각각을 붙인 뒤 elution한 것입니다.
박스 표시는 His 공벡터와 His-goi 추정 사이즈입니다.
답변하기
할인행사 광고 검색광고
케이비티 케이비티
Mixer, Dry Bath, Heating Block, Thermo Shaker, Shaking Incub.. (10.22까지)
다온비에스 다온비에스
내 소중한 세포를 위해 안심하고 맡길 수 있는 WOLF Cell Sorter를 경험하세요! (12.31까지)
필코리아테크놀로지 필코리아테크놀로지
무료 샘플로 명품 NEB의 DNA/RNA Purifucation 성능을 경험하세요. / COVID-19 연구.. (9.29까지)
에펜도르프코리아 에펜도르프코리아
[에펜도르프코리아] Eppendorf 2020 하반기 프로모션 행사 : 실험실 필수품 피펫,원심분리기,PCR.. (12.31까지)
인성크로마텍 인성크로마텍
Phenotype MicroArray™ - Live Cell 에너지 대사 & 감수성 프로파일링 (10.31까지)
브래디 브래디
[브래디] 초저온라벨 등 실험실용 라벨링 솔루션 (COVID19 안전사인 등) (10.30까지)
그린메이트바이오텍 그린메이트바이오텍
TECAN 한국대리점 20주년 기념 Microplate Reader & Washer 할인이 쏟아진다! (12.31까지)
프리미엄 등록안내
외부제휴사 광고 AD
e브릭몰
2/6  좌우
793,400238,100
379,000
136,000
242,40072,800
47,20044,900
887,200266,200
139,000132,100
230,000
136,000129,200
924,000
245,20073,600
79,50075,600
388,500116,600
555,000
246,60074,000
201,30060,400
80,40024,200
50,00015,000
238,70071,700
739,000702,100
309,000
158,40047,600
143,800136,700
22,7006,900
최근등록   더보기 >
여드름 항균성 실험 디스크확산법   09.19
한천 속에서 호기성 세균이 살 수 있나요?   09.19
PCR primer design에 대해서 알려주세요 ㅠㅠㅠ   09.19
증균액과 희석   09.18
분자요리 캐비어 원리   09.18
DNA digestion 프로토콜   09.18
미생물 분리 동정 실험 준비물   09.18
고체배지로 측정한 낙하균을 액체시료로 쓸 수 있는 방법이 있을까요??   09.18
BSA standard curve.. 질문 ..   09.18
RNA 추출시 RNA degradation이 일어나는 문제가 있습니다.   09.18
일루미나
실험관련연재
박은총 연재중후배에게 주고 싶은 면역학 노트
박은총(Duke University)
신코 연재중분석장비 이야기
분석장비 탐험가 (필명) ((주)신코)
Mr.S 연재중의학계의 Spectaculum: 임상시험
Mr. S (필명) (연세대학교)
에스프리 연재중실험을 해봅시다
에스프리 (필명)
곽민준 연재중랩노트
곽민준 (POSTECH 생명과학과)
이제욱 연재중생명과학자 기초체력 다지기
이제욱 (오송첨단의료산업진흥재단, 신약개발지원센터)
ZEUS
위로가기
실험 홈  |  실험FAQ  |  실험 문의 및 제안
 |  BRIC소개  |  이용안내  |  이용약관  |  개인정보처리방침  |  이메일무단수집거부
Copyright © BRIC. All rights reserved.  |  문의 member@ibric.org
트위터 트위터    페이스북 페이스북   유튜브 유튜브    RSS서비스 RSS
에펜도르프코리아 광고