실험 Q&A Microbiology > Virus
Gnenbank등록시 질문사항
레벨1 에너자이저
Dear Dr. Park: While processing your GenBank submissions JQ417862-JQ417886, we have come across an issue that requires your attention. Internal stop codons have been detected in the conceptual translation of the coding region span you indicated for: SEQ_FEAT:InternalStop JQ417873:CDS polyprotein gb|JQ417873|:<1->427 JQ417879:CDS polyprotein gb|JQ417879|:<1->425 If the nucleotide sequences are incorrect, send us the corrected sequences as a FASTA set and we will replace the current sequences in your submission. However, if the sequences in your submission are correct, please explain the presence of these internal stop codons. Send your reply to: gb-admin@ncbi.nlm.nih.gov Appended for your reference, please find the GenBank flatfiles in which each internal stop is noted as '*' in the conceptual translations. We cannot release your submissions in GenBank until these internal stop codons have been resolved. Thank you for your attention, and we look forward to hearing from you soon. Please reply using the original subject line. This will allow for faster processing of your correspondence. Sincerely, Ilene Mizrachi, PhD The GenBank Submissions Staff Bethesda, Maryland USA ----------------- working GenBank flatfiles: LOCUS JQ417862 433 bp RNA linear VRL 19-OCT-2012 DEFINITION Human rhinovirus sp. isolate SE-10-029 polyprotein gene, partial cds. ACCESSION JQ417862 VERSION JQ417862 KEYWORDS . SOURCE Human rhinovirus sp. ORGANISM Human rhinovirus sp. Viruses; ssRNA positive-strand viruses, no DNA stage; Picornavirales; Picornaviridae; Enterovirus; unclassified Rhinovirus. REFERENCE 1 (bases 1 to 433) AUTHORS TITLE Direct Submission JOURNAL Submitted (17-JAN-2012) Microbiology, FEATURES Location/Qualifiers source 1..433 /organism="Human rhinovirus sp." /mol_type="genomic RNA" /isolate="SE-10-029" /isolation_source="nasal swab" /host="Homo sapiens" /db_xref="taxon:169066" /country="South Korea" CDS <1..>433 /note="VP4/VP2" /codon_start=3 /product="polyprotein" /translation="VSRQNVGTHSTQNAVSNGSSLNYFNINYFKDAASSGASKLEFSQ DPSKFTDPVKDVLEKGIPTLQSPTVEACGYSDRIIQITRGDSTITSQDVANAVVGYGV WPHYLTPQDATAIDKPSRPDTSSNRFYTLASKEWDYNSKGW" ORIGIN 1 aagtttcaag acagaatgtt ggtacacact ctacacagaa tgcagtttca aatggatcaa 61 gcctgaatta tttcaacata aattatttta aggatgctgc atctagcggt gcatcaaagc 121 ttgaattctc gcaggaccca agtaagttca cagacccagt taaggatgta ttggaaaaag 181 gaatccccac tctgcaatct ccaactgtag aggcatgtgg atattcagat agaatcatac 241 aaattacaag aggagattct acaataacat cacaggatgt tgcaaatgct gttgttggtt 301 atggcgtgtg gcctcattat ctgacacctc aggatgctac agctatagac aagccctccc 361 gaccagatac ttcttctaat agattctaca ccttagctag taaggaatgg gactacaatt 421 ctaagggctg gtg // |
Bio마켓 프리미엄